HORDB

ID: hor000746
Uniprot ID: P04404
Protein name: WE-14
Gene name: CHGA
Organism: Sus scrofa (Pig)
Family: Chromogranin/secretogranin protein family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0002551 mast cell chemotaxis; GO:0033604 negative regulation of catecholamine secretion; GO:0042742 defense response to bacterium; GO:0043303 mast cell degranulation; GO:0045576 mast cell activation; GO:0046676 negative regulation of insulin secretion; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0086030 adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation; GO:2000707 positive regulation of dense core granule biogenesis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0042583 chromaffin granule; GO:0098992 neuronal dense core vesicle

Sequence: WSKMDRLAKELTAE
Length: 14(328-341)
Propeptide: SAAALALLLCAGQVIALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERSHQQKKQSSYEDELSEVLEKQNDQAELKEGTEEASSKEAAEKRGDSKEVEKNDEDADGAKPQASLEPPXXXEAEDQTPGEEEAASTHPLASLPSKKRPGAQAEEDHEGPSQGPVDREKGPSAEQGPQAEREEEEEAEAGEKAVPEEEGPRSEAFDSHPSLGYKEMQR
Signal peptide: SAAALALLLCAGQVIA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Pancreastatin]: Strongly inhibits glucose induced insulin release from the pancreas.; [Parastatin]: Inhibits low calcium-stimulated parathyroid cell secretion.; [Catestatin]: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons
Mechanism: Binds calcium with a low-affinity.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000746_AF2.pdb

hor000746_ESM.pdb

Mass:	191000	Formula:	C73H120N20O23S
Absent amino acids:	CFGHINPQVY	Common amino acids:	AEKL
pI:	6.59	Basic residues:	3
Polar residues:	2	Hydrophobic residues:	5
Hydrophobicity:	-86.43	Boman Index:	-3619
Half-Life:	2.8 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	70
Instability Index:	2718.57	Extinction Coefficient cystines:	5500
Absorbance 280nm:	423.08